Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL8 protein (Active)

This Human CCL8 protein (Active) spans the amino acid sequence from region 24-99aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

HC14, Monocyte chemotactic protein 2, MCP-2, Small-inducible cytokine A8

UniProt

P80075

Expression Region

24-99aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C11orf73 knockout cell line
ABC-KH1681 1 Vial

Human C11orf73 knockout cell line

Sign In for Pricing
View Details
Lentiviral human ETV1 shRNA (UAS) - Lentiviral human ETV1 shRNA (UAS) plasmid
GTR15104935 1 Vial

Lentiviral human ETV1 shRNA (UAS) - Lentiviral human ETV1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rab27b (NM_053459) Rat Tagged Lenti ORF Clone
RR203341L3 10 µg

Rab27b (NM_053459) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Canine ACVRL1 Protein, Fc Tag
PCA164 100 µg

Canine ACVRL1 Protein, Fc Tag

Sign In for Pricing
View Details
Spetex-2E Recombinant Protein (Rat)
RP230765 100 µg

Spetex-2E Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rat FBL shRNA Plasmid
abx988575-01 150 µg

Rat FBL shRNA Plasmid

Sign In for Pricing
View Details