Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XCL1 protein (Active)

This Human XCL1 protein (Active) spans the amino acid sequence from region 23-114aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

ATAC, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1

UniProt

P47992

Expression Region

23-114aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

10.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRP Recombinant Protein (Human)
RP029980 100 µg

SPRP Recombinant Protein (Human)

Sign In for Pricing
View Details
Rat Ccar2 Pre-designed siRNA Set A
SI202066A 1 Each

Rat Ccar2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TIMM8B Antibody
orb2679924-01 50 µL

TIMM8B Antibody

Sign In for Pricing
View Details
TIMM8B Antibody
orb2679924-02 100 µL

TIMM8B Antibody

Sign In for Pricing
View Details
TIMM8B Antibody
orb2679924-03 200 µL

TIMM8B Antibody

Sign In for Pricing
View Details
F (ab') 2 Donkey Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody (HRP)
orb1531022 0.5 mg

F (ab') 2 Donkey Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody (HRP)

Sign In for Pricing
View Details