Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VCC1 protein (Active)

This Human VCC1 protein (Active) spans the amino acid sequence from region 22-119aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 17, DMC

UniProt

Q6UXB2

Expression Region

22-119aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/mg.

Form

Lyophilized powder

Molecular Weight

11.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ10490 Recombinant Protein (Human)
RP012271 100 µg

FLJ10490 Recombinant Protein (Human)

Sign In for Pricing
View Details
Esomeprazole
E6009-250mg 250 mg

Esomeprazole

Sign In for Pricing
View Details
Dehydrosulphurenic acid
TN7664-01 10 mg

Dehydrosulphurenic acid

Sign In for Pricing
View Details
Dehydrosulphurenic acid
TN7664-02 50 mg

Dehydrosulphurenic acid

Sign In for Pricing
View Details
Oxalate Oxidase
orb2663532-01 1 mg

Oxalate Oxidase

Sign In for Pricing
View Details
Oxalate Oxidase
orb2663532-02 5 mg

Oxalate Oxidase

Sign In for Pricing
View Details