Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL9 protein (Active)

This Human CXCL9 protein (Active) spans the amino acid sequence from region 23-125aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Gamma-interferon-induced monokine, HuMIG, MIG, Small-inducible cytokine B9

UniProt

Q07325

Expression Region

23-125aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 100 ng/ml.

Form

Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.

AA Sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA1 (phospho-Ser265)  rabbit pAb
UB-GEN-1418 100 µL

FRA1 (phospho-Ser265) rabbit pAb

Sign In for Pricing
View Details
FER pTyr402 Rabbit Polyclonal Antibody
AP55754PU-S 50 µL

FER pTyr402 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBE2W Recombinant Protein
OPCA02393-1MG 1 mg

UBE2W Recombinant Protein

Sign In for Pricing
View Details
(1R,2R) -N, N-Bis[2- (Diphenylphosphino) Benzyl]Cyclohexane-1,2-Diamine
OR1007883-01 100 mg

(1R,2R) -N, N-Bis[2- (Diphenylphosphino) Benzyl]Cyclohexane-1,2-Diamine

Sign In for Pricing
View Details
(1R,2R) -N, N-Bis[2- (Diphenylphosphino) Benzyl]Cyclohexane-1,2-Diamine
OR1007883-02 250 mg

(1R,2R) -N, N-Bis[2- (Diphenylphosphino) Benzyl]Cyclohexane-1,2-Diamine

Sign In for Pricing
View Details
(1R,2R) -N, N-Bis[2- (Diphenylphosphino) Benzyl]Cyclohexane-1,2-Diamine
OR1007883-03 1 g

(1R,2R) -N, N-Bis[2- (Diphenylphosphino) Benzyl]Cyclohexane-1,2-Diamine

Sign In for Pricing
View Details