Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL7 protein (Active)

This Human CXCL7 protein (Active) spans the amino acid sequence from region 59-128aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PBP, Leukocyte-derived growth factor, LDGF, Macrophage-derived growth factor, MDGF

UniProt

P02775

Expression Region

59-128aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 1.0-10.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPA1P19 Protein Vector (Human) (pPM-C-HA)
PV084123 500 ng

HNRNPA1P19 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant AMPV M/Matrix protein Protein, C-His
EVV41801 100 μg

Recombinant AMPV M/Matrix protein Protein, C-His

Sign In for Pricing
View Details
Nori® Hamster TNFRII ELISA Kit
GR172039 96 Well

Nori® Hamster TNFRII ELISA Kit

Sign In for Pricing
View Details
Copper (II) tartrate hydrate
TYD-01747-01 100 mg

Copper (II) tartrate hydrate

Sign In for Pricing
View Details
Copper (II) tartrate hydrate
TYD-01747-02 250 mg

Copper (II) tartrate hydrate

Sign In for Pricing
View Details
Copper (II) tartrate hydrate
TYD-01747-03 50 mg

Copper (II) tartrate hydrate

Sign In for Pricing
View Details