Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL7 protein (Active)

This Human CXCL7 protein (Active) spans the amino acid sequence from region 59-128aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PBP, Leukocyte-derived growth factor, LDGF, Macrophage-derived growth factor, MDGF

UniProt

P02775

Expression Region

59-128aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 1.0-10.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CCNO shRNA (UAS) - Lentiviral human CCNO shRNA (UAS, GFP) (100)
GTR15324636 1 Vial

Lentiviral human CCNO shRNA (UAS) - Lentiviral human CCNO shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]
MBS2579536-01 20 Tests

FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]

Sign In for Pricing
View Details
FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]
MBS2579536-02 100 Tests

FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]

Sign In for Pricing
View Details
FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]
MBS2579536-03 2x 100 Tests

FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]

Sign In for Pricing
View Details
FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]
MBS2579536-04 10x 100 Tests

FluorViolet 610 Anti-Human CD11b Antibody [ICRF44]

Sign In for Pricing
View Details
PDZK1 Antibody (Center) Blocking Peptide
MBS9221163-01 0.5 mg

PDZK1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details