Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL6 protein (Active)

This Human CXCL6 protein (Active) spans the amino acid sequence from region 43-114aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Chemokine alpha 3, Granulocyte chemotactic protein 2, GCP-2, Small-inducible cytokine B6

UniProt

P80162

Expression Region

43-114aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-50 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl Laurate
455939-01 2.5 g

Methyl Laurate

Sign In for Pricing
View Details
Methyl Laurate
455939-02 5 g

Methyl Laurate

Sign In for Pricing
View Details
Lentiviral mouse Gm5458 shRNA (UAS) - Lentiviral mouse Gm5458 shRNA (UAS, RFP) (100)
GTR15199440 1 Vial

Lentiviral mouse Gm5458 shRNA (UAS) - Lentiviral mouse Gm5458 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Dog/Canine A Kinase Prka Anchor Protein-Gravin 12 AKap12 ELISA Kit
BG-CAN10272 1 Each

Dog/Canine A Kinase Prka Anchor Protein-Gravin 12 AKap12 ELISA Kit

Sign In for Pricing
View Details
SOCS-2 Polyclonal Antibody
MBS9245254-01 0.1 mL

SOCS-2 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS-2 Polyclonal Antibody
MBS9245254-02 5x 0.1 mL

SOCS-2 Polyclonal Antibody

Sign In for Pricing
View Details