Human CXCL5 protein (Active)
This Human CXCL5 protein (Active) spans the amino acid sequence from region 44-114aa. Purity: > 95% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
ENA-78, Epithelial-derived neutrophil-activating protein 78, Neutrophil-activating peptide ENA-78, Small-inducible cytokine B5
UniProt
P42830
Expression Region
44-114aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 95% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml.
Form
Lyophilized powder
Molecular Weight
7.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 2 x PBS, pH 7.4
AA Sequence
LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1432911-01 0.02 mg (E-Coli)
Recombinant Lepus capensis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1432911-02 0.1 mg (E-Coli)
Recombinant Lepus capensis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1432911-03 0.02 mg (Yeast)
Recombinant Lepus capensis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1432911-04 0.1 mg (Yeast)
Recombinant Lepus capensis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1432911-05 0.02 mg (Baculovirus)
Recombinant Lepus capensis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1432911-06 1 mg (E-Coli)
Recombinant Lepus capensis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details