Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLF4 protein (Active)

This Human PLF4 protein (Active) spans the amino acid sequence from region 32-101aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PF-4, Iroplact, Oncostatin-A,

UniProt

P02776

Expression Region

32-101aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human fibroblasts is in a concentration of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal GRM2 / MGLUR2 Antibody (N-Terminus)
APR12291G 0.05mg

Polyclonal GRM2 / MGLUR2 Antibody (N-Terminus)

Sign In for Pricing
View Details
SNORD42B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2228406 1.0 µg DNA

SNORD42B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CCZ1B Antibody - N-terminal region : Biotin (ARP69507_P050-Biotin)
ARP69507_P050-Biotin 100 µL

CCZ1B Antibody - N-terminal region : Biotin (ARP69507_P050-Biotin)

Sign In for Pricing
View Details
ELISA Kit For Alpha-protein kinase 1
E15536h 96 Tests

ELISA Kit For Alpha-protein kinase 1

Sign In for Pricing
View Details
CD40LG CRISPR Knock Out 293T Cell Line (Human)
15544141 1x 10^6 Cells / 1.0 mL

CD40LG CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Brucella Goat Polyclonal Antibody (HRP)
orb475103 100 µL

Brucella Goat Polyclonal Antibody (HRP)

Sign In for Pricing
View Details