Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLF4 protein (Active)

This Human PLF4 protein (Active) spans the amino acid sequence from region 32-101aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PF-4, Iroplact, Oncostatin-A,

UniProt

P02776

Expression Region

32-101aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human fibroblasts is in a concentration of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque OR4F3 Protein, His (Fc)-Avi-tagged
OR4F3-3021R 50 µg

Recombinant Rhesus Macaque OR4F3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
IL20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
24858111 3x 1.0 µg

IL20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SIGLEC6 (NM_198845) Human Tagged ORF Clone
RC206611 10 µg

SIGLEC6 (NM_198845) Human Tagged ORF Clone

Sign In for Pricing
View Details
Gm2083 Mouse Gene Knockout Kit (CRISPR)
KN506790 1 Kit

Gm2083 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SKP2 Antibody
MBS5312586-01 0.1 mg

SKP2 Antibody

Sign In for Pricing
View Details
SKP2 Antibody
MBS5312586-02 5x 0.1 mg

SKP2 Antibody

Sign In for Pricing
View Details