Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL3 protein (Active)

This Human CXCL3 protein (Active) spans the amino acid sequence from region 35-107aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

GRO-gamma, Growth-regulated protein gamma, GRO-gamma, Macrophage inflammatory protein 2-beta, MIP2-beta

UniProt

P19876

Expression Region

35-107aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gallus IL-2 ELISA Kit
orb1216631-01 1 set (1 x capture antibody)

Gallus IL-2 ELISA Kit

Sign In for Pricing
View Details
Gallus IL-2 ELISA Kit
orb1216631-02 1 set (2 x capture antibody)

Gallus IL-2 ELISA Kit

Sign In for Pricing
View Details
Nav1 3'UTR GFP Stable Cell Line
TU163856 1.0 mL

Nav1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Isopropyl 2,4,6-trichloronicotinate
OR1090691-01 250 mg

Isopropyl 2,4,6-trichloronicotinate

Sign In for Pricing
View Details
Isopropyl 2,4,6-trichloronicotinate
OR1090691-02 1 g

Isopropyl 2,4,6-trichloronicotinate

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072675-01 0.1 mL

PE-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details