Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL2 protein (Active)

This Human CXCL2 protein (Active) spans the amino acid sequence from region 35-107aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Growth-regulated protein beta, Macrophage inflammatory protein 2-alpha, MIP2-alpha, , GRO-beta-T

UniProt

P19875

Expression Region

35-107aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPTIN1 Antibody / SEPT1
RQ7246 100 µg

SEPTIN1 Antibody / SEPT1

Sign In for Pricing
View Details
Density Regulated Protein (Density-regulated Protein, DENR, DRP, DRP1, SMAP-3) (MaxLight 750)
MBS6413954-01 0.1 mL

Density Regulated Protein (Density-regulated Protein, DENR, DRP, DRP1, SMAP-3) (MaxLight 750)

Sign In for Pricing
View Details
Density Regulated Protein (Density-regulated Protein, DENR, DRP, DRP1, SMAP-3) (MaxLight 750)
MBS6413954-02 5x 0.1 mL

Density Regulated Protein (Density-regulated Protein, DENR, DRP, DRP1, SMAP-3) (MaxLight 750)

Sign In for Pricing
View Details
CPT2, ID (CPT2, CPT1, Carnitine O-palmitoyltransferase 2, mitochondrial, Carnitine palmitoyltransferase II) (Biotin) discontinued
034190-Biotin 200 µL

CPT2, ID (CPT2, CPT1, Carnitine O-palmitoyltransferase 2, mitochondrial, Carnitine palmitoyltransferase II) (Biotin) discontinued

Sign In for Pricing
View Details
1700030K09Rik ORF Vector (Mouse) (pORF)
ORF036799 1.0 µg DNA

1700030K09Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Ethylenediamine-N, N′-diglutaric acid
HY-W127814 1 Each

Ethylenediamine-N, N′-diglutaric acid

Sign In for Pricing
View Details