Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL2 protein (Active)

This Human CXCL2 protein (Active) spans the amino acid sequence from region 35-107aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Growth-regulated protein beta, Macrophage inflammatory protein 2-alpha, MIP2-alpha, , GRO-beta-T

UniProt

P19875

Expression Region

35-107aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-mouse Protein S100-A8 polyclonal Antibody, FITC
MBS1495298-01 0.05 mg

Rabbit anti-mouse Protein S100-A8 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-mouse Protein S100-A8 polyclonal Antibody, FITC
MBS1495298-02 0.1 mg

Rabbit anti-mouse Protein S100-A8 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-mouse Protein S100-A8 polyclonal Antibody, FITC
MBS1495298-03 5x 0.1 mg

Rabbit anti-mouse Protein S100-A8 polyclonal Antibody, FITC

Sign In for Pricing
View Details
8-Hydroxyodoroside A
379443 5 mg

8-Hydroxyodoroside A

Sign In for Pricing
View Details
Simax Buchner Flask 2L
FLA3806 1 Each

Simax Buchner Flask 2L

Sign In for Pricing
View Details
Factor VIII Rabbit Polyclonal Antibody (Cy7)
orb1054314 100 µL

Factor VIII Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details