Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL18 protein (Active)

This Human CCL18 protein (Active) spans the amino acid sequence from region 21-89aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Alternative macrophage activation-associated CC chemokine 1, CC chemokine PARC, Dendritic cell chemokine 1, DC-CK1, Macrophage inflammatory protein 4

UniProt

P55774

Expression Region

21-89aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.

AA Sequence

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit
MBS1604147-01 48 Well

Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit

Sign In for Pricing
View Details
Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit
MBS1604147-02 96 Well

Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit

Sign In for Pricing
View Details
Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit
MBS1604147-03 5x 96 Well

Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit

Sign In for Pricing
View Details
Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit
MBS1604147-04 10x 96 Well

Hamster Tumor necrosis factor Gamma, TNF-G ELISA Kit

Sign In for Pricing
View Details
Rat Nfe2l3 Pre-designed siRNA Set A
SI209254A 1 Each

Rat Nfe2l3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NuDT4, 1-180aa, Human, His tag, E Coli
MBS204958-01 0.01 mg

NuDT4, 1-180aa, Human, His tag, E Coli

Sign In for Pricing
View Details