Human CCL17 protein (Active)
This Human CCL17 protein (Active) spans the amino acid sequence from region 24-94aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
CC chemokine TARC, Thymus and activation-regulated chemokine
UniProt
Q92583
Expression Region
24-94aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.
Form
Lyophilized powder
Molecular Weight
8.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20mM PB, pH 7.4, 150mM NaCl
AA Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6360286-01 0.1 mL
TULP1, ID (TULP1, TUBL1, Tubby-related protein 1, Tubby-like protein 1) (MaxLight 750)
Sign In for Pricing
View Details MBS6360286-02 5x 0.1 mL
TULP1, ID (TULP1, TUBL1, Tubby-related protein 1, Tubby-like protein 1) (MaxLight 750)
Sign In for Pricing
View Details A16793-1-Fluoro647 100 µg/Vial
Anti-TMED8 Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details 
MBS7266001-01 48 Well
Sheep Phosphorylated Caldesmon Kinase II ELISA Kit
Sign In for Pricing
View Details MBS7266001-02 96 Well
Sheep Phosphorylated Caldesmon Kinase II ELISA Kit
Sign In for Pricing
View Details