Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL17 protein (Active)

This Human CCL17 protein (Active) spans the amino acid sequence from region 24-94aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

CC chemokine TARC, Thymus and activation-regulated chemokine

UniProt

Q92583

Expression Region

24-94aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20mM PB, pH 7.4, 150mM NaCl

AA Sequence

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLGAP3 Protein Vector (Mouse) (pPB-N-His)
PV172311 500 ng

DLGAP3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Aquaporin 1/AQP1 Rabbit Polyclonal Antibody (Cy3)
orb2580211 100 µg

Aquaporin 1/AQP1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Glycoprotein VI, Control Peptide (GPVI, GP6, Platelet glycoprotein VI precursor, MGC138168)
G4906-01B 50 µg

Glycoprotein VI, Control Peptide (GPVI, GP6, Platelet glycoprotein VI precursor, MGC138168)

Sign In for Pricing
View Details
RAD9 Peptide
DF6678-BP 1 mg

RAD9 Peptide

Sign In for Pricing
View Details
Human Carnosinase 2 (CNDP2) ELISA Kit
YP-W101732-01 48 Tests

Human Carnosinase 2 (CNDP2) ELISA Kit

Sign In for Pricing
View Details
Human Carnosinase 2 (CNDP2) ELISA Kit
YP-W101732-02 96 Tests

Human Carnosinase 2 (CNDP2) ELISA Kit

Sign In for Pricing
View Details