Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL15 protein (Active)

This Human CCL15 protein (Active) spans the amino acid sequence from region 46-113aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Chemokine CC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5

UniProt

Q16663

Expression Region

46-113aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Htr2c Mouse Gene Knockout Kit (CRISPR)
KN508030 1 Kit

Htr2c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMB Horseradish Peroxidase Color Development Solution for ELISA
P0209-500ml 500 mL

TMB Horseradish Peroxidase Color Development Solution for ELISA

Sign In for Pricing
View Details
Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit
MBS9397935-01 48 Well

Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit

Sign In for Pricing
View Details
Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit
MBS9397935-02 96 Well

Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit

Sign In for Pricing
View Details
Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit
MBS9397935-03 5x 96 Well

Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit

Sign In for Pricing
View Details
Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit
MBS9397935-04 10x 96 Well

Bovine Fc Receptor-Like Protein 4 (FCRL4) ELISA Kit

Sign In for Pricing
View Details