Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CSF1 protein (Active)

This Mouse CSF1 protein (Active) spans the amino acid sequence from region 33-262aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

CSF-1

UniProt

P07141

Expression Region

33-262aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine M-NFS-60 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

26 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris, 500 mM NaCl, pH 7.4

AA Sequence

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCGR Antibody
37596 100 µL

GCGR Antibody

Sign In for Pricing
View Details
Recombinant Human Ephrin-A1/EFNA1/LERK-1 (C-6His)
CA70-1mg 1 mg

Recombinant Human Ephrin-A1/EFNA1/LERK-1 (C-6His)

Sign In for Pricing
View Details
SafeDye 100bp Ladder Plus
53261 50 µg

SafeDye 100bp Ladder Plus

Sign In for Pricing
View Details
Z-Asn-Gly-OH trifluoroacetate
BA183633-01 0.1 g

Z-Asn-Gly-OH trifluoroacetate

Sign In for Pricing
View Details
Z-Asn-Gly-OH trifluoroacetate
BA183633-02 0.25 g

Z-Asn-Gly-OH trifluoroacetate

Sign In for Pricing
View Details
Z-Asn-Gly-OH trifluoroacetate
BA183633-03 0.5 g

Z-Asn-Gly-OH trifluoroacetate

Sign In for Pricing
View Details