Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CSF2 protein (Active)

This Mouse CSF2 protein (Active) spans the amino acid sequence from region 18-141aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

GM-CSF, CSF

UniProt

P01587

Expression Region

18-141aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine FDC-P1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFE QGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKK PGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANK4 Polyclonal Antibody, PE-Cy5 Conjugated
bs-8340R-PE-Cy5 100 µL

PANK4 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
HIP14 (Palmitoyltransferase ZDHHC17, Huntingtin Yeast Partner H, Huntingtin-interacting Protein 14, HIP-14, Huntingtin-interacting Protein 3, HIP-3, Huntingtin-interacting Protein H, Putative MAPK-activating Protein PM11, Putative NF-kappa-B-activating Protein 205, Zinc Finger DHHC Domain-containing Protein 17, DHHC-17, ZDHHC17, HIP3, HYPH, KIAA0946, HSPC294)
H7960-14B 100 µg

HIP14 (Palmitoyltransferase ZDHHC17, Huntingtin Yeast Partner H, Huntingtin-interacting Protein 14, HIP-14, Huntingtin-interacting Protein 3, HIP-3, Huntingtin-interacting Protein H, Putative MAPK-activating Protein PM11, Putative NF-kappa-B-activating Protein 205, Zinc Finger DHHC Domain-containing Protein 17, DHHC-17, ZDHHC17, HIP3, HYPH, KIAA0946, HSPC294)

Sign In for Pricing
View Details
Monkeypox Virus M1R Protein, His Tag
orb2321190-01 500 µg

Monkeypox Virus M1R Protein, His Tag

Sign In for Pricing
View Details
Monkeypox Virus M1R Protein, His Tag
orb2321190-02 50 µg

Monkeypox Virus M1R Protein, His Tag

Sign In for Pricing
View Details
TGFB2 ORF Vector (Human) (pORF)
ORF033887 1.0 µg DNA

TGFB2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-Human GPR20 Antibody (SAA2139), FITC
HP581117-01 1 Each

Anti-Human GPR20 Antibody (SAA2139), FITC

Sign In for Pricing
View Details