Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey Q9GL44 protein (Active)

This Monkey Q9GL44 protein (Active) spans the amino acid sequence from region 18-144aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

CSF2

UniProt

Q9GL44

Expression Region

18-144aa

Tag

Tag-Free

Source

E.Coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQEPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFQSFKENLKDFLLVIPFDCWEPVQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7D4 Polyclonal Antibody
UB-GEN-7476 100 µL

OR7D4 Polyclonal Antibody

Sign In for Pricing
View Details
c-Raf Antibody (phospho Tyr340/Tyr341)
GWB-CD8B96 0.05 mL

c-Raf Antibody (phospho Tyr340/Tyr341)

Sign In for Pricing
View Details
Olr557 Protein Vector (Rat) (pPM-C-HA)
34500026 500 ng

Olr557 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human cyclophilin B,CyPB ELISA Kit
CN-04173H2 48T

Human cyclophilin B,CyPB ELISA Kit

Sign In for Pricing
View Details
CANT1 (Soluble Calcium-Activated nucleotidase 1, SCAN-1, Apyrase Homolog, Putative MAPK-Activating Protein PM09, Putative NF-kappa-B-Activating Protein 107, CANT1, SHAPY) (Biotin)
335065-01 50 µg

CANT1 (Soluble Calcium-Activated nucleotidase 1, SCAN-1, Apyrase Homolog, Putative MAPK-Activating Protein PM09, Putative NF-kappa-B-Activating Protein 107, CANT1, SHAPY) (Biotin)

Sign In for Pricing
View Details
CANT1 (Soluble Calcium-Activated nucleotidase 1, SCAN-1, Apyrase Homolog, Putative MAPK-Activating Protein PM09, Putative NF-kappa-B-Activating Protein 107, CANT1, SHAPY) (Biotin)
335065-02 100 µg

CANT1 (Soluble Calcium-Activated nucleotidase 1, SCAN-1, Apyrase Homolog, Putative MAPK-Activating Protein PM09, Putative NF-kappa-B-Activating Protein 107, CANT1, SHAPY) (Biotin)

Sign In for Pricing
View Details