Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SCF protein (Active)

This Mouse SCF protein (Active) spans the amino acid sequence from region 26-189aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Hematopoietic growth factor KL, MGF, Steel factor, Stem cell factor, SCF

UniProt

P20826

Expression Region

26-189aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

M+KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mthfr ORF Vector (Mouse) (pORF)
ORF050693 1.0 µg DNA

Mthfr ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CERKL Antibody, Biotin conjugated
MBS7044058-01 0.05 mg

CERKL Antibody, Biotin conjugated

Sign In for Pricing
View Details
CERKL Antibody, Biotin conjugated
MBS7044058-02 0.1 mg

CERKL Antibody, Biotin conjugated

Sign In for Pricing
View Details
CERKL Antibody, Biotin conjugated
MBS7044058-03 5x 0.1 mg

CERKL Antibody, Biotin conjugated

Sign In for Pricing
View Details
CDKN2A/p16INK4A + CDKN2B/p15INK4B Antibody [C7F9]
C20004-50uL 50 μL

CDKN2A/p16INK4A + CDKN2B/p15INK4B Antibody [C7F9]

Sign In for Pricing
View Details
Talaporfin
HY-16477A 1 Each

Talaporfin

Sign In for Pricing
View Details