Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSF3 protein (Active)

This Human CSF3 protein (Active) spans the amino acid sequence from region 31-204aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

G-CSF, Filgrastim, Lenograstim

UniProt

P09919

Expression Region

31-204aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 10mM sodium acetate buffer, containing 5 % trehalose, pH 4.0

AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1A1L Polyclonal Antibody, RBITC Conjugated
bs-12943R-RBITC 100 µL

CSNK1A1L Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
JNJ-38877618
527725 5.0mg

JNJ-38877618

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii U3 small nucleolar RNA-associated protein 25 (UTP25), partial
MBS1128612 Inquire

Recombinant Zygosaccharomyces rouxii U3 small nucleolar RNA-associated protein 25 (UTP25), partial

Sign In for Pricing
View Details
Vrk1 siRNA Oligos set (Mouse)
50198174 3x 5 nmol

Vrk1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Human TXNL1 Protein, N-His
orb2965507-01 50 µg

Recombinant Human TXNL1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TXNL1 Protein, N-His
orb2965507-02 100 µg

Recombinant Human TXNL1 Protein, N-His

Sign In for Pricing
View Details