Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL36A protein (Active)

This Mouse IL36A protein (Active) spans the amino acid sequence from region 1-160aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FIL1 epsilon, IL-1 epsilon, Interleukin-1 family member 6, IL-1F6, Interleukin-1 homolog 1

UniProt

Q9JLA2

Expression Region

1-160aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rMuIL-36α at 1 μg/mL can bind recombinant murine IL-1 Rrp2 with a range of 0.15-5 μg/mL.

Form

Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, 5 % trehalose

AA Sequence

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072672-01 0.1 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072672-02 0.2 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072672-03 0.5 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072672-04 1 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072672-05 5 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072672-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details