Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL33 protein (Active)

This Mouse IL33 protein (Active) spans the amino acid sequence from region 109-266aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-33, ; Interleukin-33109-266, ]

UniProt

Q8BVZ5

Expression Region

109-266aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.5 kDa

References & Citations

Peng Wang 1, Shuqi Yang 1, Changcheng Li 2, Baohua Ma 3, Mengqiu Yi 1, Xiaobo Chen 4, Min Yu Sulfotransferase homolog 2 receptors blockade on monocyte subsets along with their inflammatory cytokines for septic lung injury Exp Lung Res, (2024)

Pubmed id

39243130

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, and 1 mM EDTA

AA Sequence

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F1 Antibody
orb2678979-01 50 µL

E2F1 Antibody

Sign In for Pricing
View Details
E2F1 Antibody
orb2678979-02 100 µL

E2F1 Antibody

Sign In for Pricing
View Details
E2F1 Antibody
orb2678979-03 200 µL

E2F1 Antibody

Sign In for Pricing
View Details
Bim, BH3 Domain (BCL2L11, BIM, Bcl-2-like protein 11, Bcl2-interacting mediator of cell death) (Azide free) (HRP) discontinued
032519-HRP 200 µL

Bim, BH3 Domain (BCL2L11, BIM, Bcl-2-like protein 11, Bcl2-interacting mediator of cell death) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
ADAMDEC1 Antibody, FITC conjugated
CSB-PA001297LC01HU-01 50 µg

ADAMDEC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ADAMDEC1 Antibody, FITC conjugated
CSB-PA001297LC01HU-02 100 µg

ADAMDEC1 Antibody, FITC conjugated

Sign In for Pricing
View Details