Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL21 protein (Active)

This Mouse IL21 protein (Active) spans the amino acid sequence from region 18-146aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-21

UniProt

Q9ES17

Expression Region

18-146aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human N1186 T cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 x 10 ^ 4 IU/mg.

Form

Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 2 x PBS, pH 7.4

AA Sequence

HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM74B CytoSection
TS411677P5 25 Slides

TMEM74B CytoSection

Sign In for Pricing
View Details
Receptor-type tyrosine-protein phosphatase alpha
AP86856-01 50 µg

Receptor-type tyrosine-protein phosphatase alpha

Sign In for Pricing
View Details
Receptor-type tyrosine-protein phosphatase alpha
AP86856-02 100 µg

Receptor-type tyrosine-protein phosphatase alpha

Sign In for Pricing
View Details
Receptor-type tyrosine-protein phosphatase alpha
AP86856-03 1 mg

Receptor-type tyrosine-protein phosphatase alpha

Sign In for Pricing
View Details
Tuba3a Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV679474 1.0 µg DNA

Tuba3a Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
GSTM1 Mouse mAb
63706 100 µL

GSTM1 Mouse mAb

Sign In for Pricing
View Details