Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL9 protein (Active)

This Mouse IL9 protein (Active) spans the amino acid sequence from region 19-144aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-9, T-cell growth factor P40

UniProt

P15247

Expression Region

19-144aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine TS1 cells is less than 0.02 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RAGE (Renal Tumor Antigen) ELISA Kit
EK247953 96 Well

Mouse RAGE (Renal Tumor Antigen) ELISA Kit

Sign In for Pricing
View Details
NEMF Human Pre-designed siRNA Set A
HY-RS09206 1 Set

NEMF Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal ATP2C1 Antibody [PerCP]
NBP1-76566PCP 0.1 mL

Rabbit Polyclonal ATP2C1 Antibody [PerCP]

Sign In for Pricing
View Details
SLC24A6 Rabbit Polyclonal Antibody (Cy7)
orb1079952 100 µL

SLC24A6 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Dark Room for TI470
59060101 1 Unit

Dark Room for TI470

Sign In for Pricing
View Details
Anti-AP3B1 Polyclonal Antibody
PHA05101 100 μg

Anti-AP3B1 Polyclonal Antibody

Sign In for Pricing
View Details