Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL9 protein (Active)

This Mouse IL9 protein (Active) spans the amino acid sequence from region 19-144aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-9, T-cell growth factor P40

UniProt

P15247

Expression Region

19-144aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine TS1 cells is less than 0.02 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Polyclonal Sheep anti-Mouse Ig Kappa Light Chain Secondary Antibody [FITC] (Azide Free)
NBP2-69223 1 mL

Sheep Polyclonal Sheep anti-Mouse Ig Kappa Light Chain Secondary Antibody [FITC] (Azide Free)

Sign In for Pricing
View Details
pECMV-Cacng7-m-FLAG Plasmid
PVT15200 2 µg

pECMV-Cacng7-m-FLAG Plasmid

Sign In for Pricing
View Details
HTF9C (TRMT2A) Mouse Monoclonal Antibody [Clone ID: OTI3D8]
TA505517 100 µL

HTF9C (TRMT2A) Mouse Monoclonal Antibody [Clone ID: OTI3D8]

Sign In for Pricing
View Details
Anti-Human IL13 Recombinant Antibody (Abrezekimab)
YR1500-01 1 mg

Anti-Human IL13 Recombinant Antibody (Abrezekimab)

Sign In for Pricing
View Details
Anti-Human IL13 Recombinant Antibody (Abrezekimab)
YR1500-02 5 mg

Anti-Human IL13 Recombinant Antibody (Abrezekimab)

Sign In for Pricing
View Details
Donkey Brain Acid Soluble Protein 1 (BASP1) ELISA Kit
MBS9393581 Inquire

Donkey Brain Acid Soluble Protein 1 (BASP1) ELISA Kit

Sign In for Pricing
View Details