Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL7 protein (Active)

This Mouse IL7 protein (Active) spans the amino acid sequence from region 26-154aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-7

UniProt

P10168

Expression Region

26-154aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine 2E8 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, 2 % trehalose

AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6 (D-8) Alexa Fluor® 546
sc-390735 AF546 200 µg/mL

C6 (D-8) Alexa Fluor® 546

Sign In for Pricing
View Details
ST3GAL2 (NM_006927) Human Tagged ORF Clone Lentiviral Particle
RC207761L2V 200 µL

ST3GAL2 (NM_006927) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SERPINB3 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62447R-BF594-TR 20 µL

SERPINB3 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Anti-SEC14L3/TAP2 Antibody Picoband®, PE Conjugate
A14501-1-PE 100 µg/Vial

Anti-SEC14L3/TAP2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Anti-RAMP1 antibody
PAab07097 100 µg

Anti-RAMP1 antibody

Sign In for Pricing
View Details
Guinea Pig Regucalcin (RGN) ELISA Kit
GTR10319584 96 Well

Guinea Pig Regucalcin (RGN) ELISA Kit

Sign In for Pricing
View Details