Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL5 protein (Active)

This Mouse IL5 protein (Active) spans the amino acid sequence from region 21-133aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-5, BCGF-II, Cytotoxic T-lymphocyte inducer, Eosinophil differentiation factor, T-cell replacing factor

UniProt

P04401

Expression Region

21-133aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris, pH 9.0, 150 mM NaCl

AA Sequence

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Juxtanodin (JN) ELISA Kit
MBS453877-01 48 Tests

Human Juxtanodin (JN) ELISA Kit

Sign In for Pricing
View Details
Human Juxtanodin (JN) ELISA Kit
MBS453877-02 96 Tests

Human Juxtanodin (JN) ELISA Kit

Sign In for Pricing
View Details
Human Juxtanodin (JN) ELISA Kit
MBS453877-03 5x 96 Tests

Human Juxtanodin (JN) ELISA Kit

Sign In for Pricing
View Details
Human Juxtanodin (JN) ELISA Kit
MBS453877-04 10x 96 Tests

Human Juxtanodin (JN) ELISA Kit

Sign In for Pricing
View Details
AHA1 (AHSA1) Mouse Monoclonal Antibody [Clone ID: LBI1D2]
AMM18680VCF 100 µg

AHA1 (AHSA1) Mouse Monoclonal Antibody [Clone ID: LBI1D2]

Sign In for Pricing
View Details
Human DDC8 siRNA
abx913736-01 15 nmol

Human DDC8 siRNA

Sign In for Pricing
View Details