Mouse IL1RA protein (Active)

DIRA protein, ICIL 1RA protein, ICIL-1RA protein, ICIL1RA protein, IL-1ra protein, IL-1ra3 protein, IL-1RN protein, IL1 inhibitor protein, IL1F3 protein, IL1RA protein, IL1RA_HUMAN protein, IL1RN (IL1F3) protein, IL1 RN protein, IL1RN protein, IL1 RA protein, Interleukin 1 receptor antagonist protein, Interleukin-1 receptor antagonist protein protein, Intracellular IL 1 receptor antagonist type II protein, Intracellular interleukin 1 receptor antagonist (icIL 1ra) protein, IRAP protein, MGC10430 protein, MVCD4 protein, Type II interleukin 1 receptor antagonist protein

Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg in the presence of 50 pg/ml rHuIL-1α.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ