Mouse IL1RA protein (Active)
This Mouse IL1RA protein (Active) spans the amino acid sequence from region 27-178aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
DIRA protein, ICIL 1RA protein, ICIL-1RA protein, ICIL1RA protein, IL-1ra protein, IL-1ra3 protein, IL-1RN protein, IL1 inhibitor protein, IL1F3 protein, IL1RA protein, IL1RA_HUMAN protein, IL1RN (IL1F3) protein, IL1 RN protein, IL1RN protein, IL1 RA protein, Interleukin 1 receptor antagonist protein, Interleukin-1 receptor antagonist protein protein, Intracellular IL 1 receptor antagonist type II protein, Intracellular interleukin 1 receptor antagonist (icIL 1ra) protein, IRAP protein, MGC10430 protein, MVCD4 protein, Type II interleukin 1 receptor antagonist protein
UniProt
P25085
Expression Region
27-178aa
Tag
Tag-Free
Source
E.Coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg in the presence of 50 pg/ml rHuIL-1α.
Form
Lyophilized powder
Molecular Weight
17.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog