Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL1 alpha protein (Active)

This Mouse IL1 alpha protein (Active) spans the amino acid sequence from region 115-270aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Hematopoietin 1 protein, Hematopoietin-1 protein, IL 1 alpha protein, IL 1 protein, IL 1A protein, IL-1 alpha protein, Il-1a protein, IL1 ALPHA protein, IL1 protein, IL1A protein, IL1A_HUMAN protein, IL1F1 protein, ilia protein, Interleukin 1 alpha protein, Interleukin 1 alpha precursor protein, Interleukin-1 alpha protein, Interleukin1 alpha protein, Preinterleukin 1 alpha protein, Pro interleukin 1 alpha protein

UniProt

P01582

Expression Region

115-270aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 2 pg/ml, corresponding to a specific activity of > 5.0 x 10 ^ 8 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) (APC)
135107-APC 100 µL

UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) (APC)

Sign In for Pricing
View Details
Anti-ARPM1 Antibody
CQA3748-01 30 µL

Anti-ARPM1 Antibody

Sign In for Pricing
View Details
Anti-ARPM1 Antibody
CQA3748-02 50 μL

Anti-ARPM1 Antibody

Sign In for Pricing
View Details
Anti-ARPM1 Antibody
CQA3748-03 100 µL

Anti-ARPM1 Antibody

Sign In for Pricing
View Details
Anti-ARPM1 Antibody
CQA3748-04 200 µL

Anti-ARPM1 Antibody

Sign In for Pricing
View Details
Hdac10 Mouse shRNA Plasmid (Locus ID 170787)
TL506091 1 Kit

Hdac10 Mouse shRNA Plasmid (Locus ID 170787)

Sign In for Pricing
View Details