Mouse IL1 alpha protein (Active)

Hematopoietin 1 protein, Hematopoietin-1 protein, IL 1 alpha protein, IL 1 protein, IL 1A protein, IL-1 alpha protein, Il-1a protein, IL1 ALPHA protein, IL1 protein, IL1A protein, IL1A_HUMAN protein, IL1F1 protein, ilia protein, Interleukin 1 alpha protein, Interleukin 1 alpha precursor protein, Interleukin-1 alpha protein, Interleukin1 alpha protein, Preinterleukin 1 alpha protein, Pro interleukin 1 alpha protein

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 2 pg/ml, corresponding to a specific activity of > 5.0 x 10 ^ 8 IU/mg.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS