Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey IL13 protein (Active)

This Monkey IL13 protein (Active) spans the amino acid sequence from region 19-132aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Allergic rhinitis protein, ALRH protein, BHR 1 protein, BHR-1 protein, BHR1 protein, IL 13 protein, IL-13 protein, IL13 protein, Interleukin 13 protein, Interleukin-13 protein, Interleukin13 protein, NC30 protein, P600 protein

UniProt

Q864V6

Expression Region

19-132aa

Tag

Tag-Free

Source

E.Coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, 3% trehalose

AA Sequence

SPSPVPRSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FYN Immunizing Peptide
MBS426524-01 0.1 mg

FYN Immunizing Peptide

Sign In for Pricing
View Details
FYN Immunizing Peptide
MBS426524-02 5x 0.1 mg

FYN Immunizing Peptide

Sign In for Pricing
View Details
GENLISA™ Human Anti-SARS-CoV-2 IgM Spike Protein ELISA - CE MARKED
KBVH015-6 1x 96 Well

GENLISA™ Human Anti-SARS-CoV-2 IgM Spike Protein ELISA - CE MARKED

Sign In for Pricing
View Details
PABPN1 CRISPR Activation Plasmid (m)
sc-424813-ACT 20 µg

PABPN1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Leukemia Inhibitory Factor (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) (MaxLight 550) discontinued
L2024-01D-ML550 100 µL

Leukemia Inhibitory Factor (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Sirtuin 1/SIRT1 Antibody (1F3) [Janelia Fluor 549]
NBP1-51641JF549 0.1 mL

Mouse Monoclonal Sirtuin 1/SIRT1 Antibody (1F3) [Janelia Fluor 549]

Sign In for Pricing
View Details