Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey IL1 alpha protein (Active)

This Monkey IL1 alpha protein (Active) spans the amino acid sequence from region 113-271aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Hematopoietin 1 protein, Hematopoietin-1 protein, IL 1 alpha protein, IL 1 protein, IL 1A protein, IL-1 alpha protein, Il-1a protein, IL1 ALPHA protein, IL1 protein, IL1A protein, IL1A_HUMAN protein, IL1F1 protein, ilia protein, Interleukin 1 alpha protein, Interleukin 1 alpha precursor protein, Interleukin-1 alpha protein, Interleukin1 alpha protein, Preinterleukin 1 alpha protein, Pro interleukin 1 alpha protein

UniProt

P48089

Expression Region

113-271aa

Tag

Tag-Free

Source

E.Coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/ml, corresponding to a specific activity of > 1.0 x 10 ^ 8 IU/mg.

Form

Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mrgbp Pre-designed siRNA Set B
SI208629B 1 Each

Rat Mrgbp Pre-designed siRNA Set B

Sign In for Pricing
View Details
4-Bromo-3-chloro-5-fluoropyridine
PC101242-01 100 mg

4-Bromo-3-chloro-5-fluoropyridine

Sign In for Pricing
View Details
4-Bromo-3-chloro-5-fluoropyridine
PC101242-02 250 mg

4-Bromo-3-chloro-5-fluoropyridine

Sign In for Pricing
View Details
4-Bromo-3-chloro-5-fluoropyridine
PC101242-03 1 g

4-Bromo-3-chloro-5-fluoropyridine

Sign In for Pricing
View Details
500 bp DNA Ladder
MD1103 1.25 mL

500 bp DNA Ladder

Sign In for Pricing
View Details
Recombinant S. cerevisiae Pyruvate carboxylase 1 Protein, His, E.coli-500ug
QP7045-ec-500ug 500ug

Recombinant S. cerevisiae Pyruvate carboxylase 1 Protein, His, E.coli-500ug

Sign In for Pricing
View Details