What is the catalog number for Human I36RA protein (Active)?

The catalog number for Human I36RA protein (Active) is orb358996.

What sizes are available for Human I36RA protein (Active)?

Human I36RA protein (Active) is available in the following size(s): 5 µg, 100 µg, 500 µg.

How many pack sizes does Human I36RA protein (Active) come in?

Human I36RA protein (Active) is available in 3 different pack sizes.

Is Human I36RA protein (Active) in stock?

Human I36RA protein (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

Human I36RA protein (Active)

This Human I36RA protein (Active) spans the amino acid sequence from region 2-155aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-36Ra, IL-1-related protein 3, IL-1RP3, Interleukin-1 HY1, IL-1HY1

UniProt

Q9UBH0

Expression Region

2-155aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-36 beta induced IL-8 secretion by human preadipocytes is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg in the presence of 20 ng/ml of recombinant human IL-36 beta.

Form

Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD