What is the catalog number for Human IL36G protein (Active)?

The catalog number for Human IL36G protein (Active) is orb358994.

What sizes are available for Human IL36G protein (Active)?

Human IL36G protein (Active) is available in the following size(s): 10 µg, 100 µg, 500 µg.

How many pack sizes does Human IL36G protein (Active) come in?

Human IL36G protein (Active) is available in 3 different pack sizes.

Is Human IL36G protein (Active) in stock?

Human IL36G protein (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

Human IL36G protein (Active)

This Human IL36G protein (Active) spans the amino acid sequence from region 1-169aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-1-related protein 2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 family member 9, IL-1F9

UniProt

Q9NZH8

Expression Region

1-169aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity is determined by its binding ability in a functional ELISA. Immobilized rHuIL-36γ at 1 μg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 μg/mL.

Form

Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND