Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36G protein (Active)

This Human IL36G protein (Active) spans the amino acid sequence from region 1-169aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-1-related protein 2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 family member 9, IL-1F9

UniProt

Q9NZH8

Expression Region

1-169aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity is determined by its binding ability in a functional ELISA. Immobilized rHuIL-36γ at 1 μg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 μg/mL.

Form

Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6752-3p miRNA Agomir
CMJ2168-01 5 nmol

Hsa-miR-6752-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6752-3p miRNA Agomir
CMJ2168-02 10 nmol

Hsa-miR-6752-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6752-3p miRNA Agomir
CMJ2168-03 20 nmol

Hsa-miR-6752-3p miRNA Agomir

Sign In for Pricing
View Details
ZMIZ2 Human Over-expression Lysate
orb1371688 20 µg

ZMIZ2 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica GPI-anchored wall transfer protein 1 (GWT1), partial
MBS7084658 Inquire

Recombinant Yarrowia lipolytica GPI-anchored wall transfer protein 1 (GWT1), partial

Sign In for Pricing
View Details
Human DLL3 (250-311) Protein, hFc Tag
orb2668282-01 10 µg

Human DLL3 (250-311) Protein, hFc Tag

Sign In for Pricing
View Details