Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36B protein (Active)

This Human IL36B protein (Active) spans the amino acid sequence from region 5-157aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FIL1 eta, IL-1 eta, Interleukin-1 family member 8, IL-1F8, Interleukin-1 homolog 2

UniProt

Q9NZH7

Expression Region

5-157aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion in human preadipocytes is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 2 x PBS, pH 7.4

AA Sequence

REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNA1 Rabbit Polyclonal Antibody
AP54758SU-N 200 µL

CHRNA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHK1 (pS345) Blocking Peptide
CBP4600-01 1 mg

CHK1 (pS345) Blocking Peptide

Sign In for Pricing
View Details
CHK1 (pS345) Blocking Peptide
CBP4600-02 5 mg

CHK1 (pS345) Blocking Peptide

Sign In for Pricing
View Details
ADAM12 siRNA (r)
sc-156123 10 µM

ADAM12 siRNA (r)

Sign In for Pricing
View Details
CD53 CRISPR Activation Plasmid (m)
sc-419561-ACT 20 µg

CD53 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
GSTO1, ID (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (FITC) discontinued
G8135-21D-FITC 200 µL

GSTO1, ID (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (FITC) discontinued

Sign In for Pricing
View Details