Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36B protein (Active)

This Human IL36B protein (Active) spans the amino acid sequence from region 5-157aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FIL1 eta, IL-1 eta, Interleukin-1 family member 8, IL-1F8, Interleukin-1 homolog 2

UniProt

Q9NZH7

Expression Region

5-157aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion in human preadipocytes is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 2 x PBS, pH 7.4

AA Sequence

REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-3175 Primers
MPH01391 150 µL - 10 µM

hsa-miR-3175 Primers

Sign In for Pricing
View Details
Rat Coupling Factor 6 (CF6) ELISA Kit
RD-CF6-Ra-01 96 Tests

Rat Coupling Factor 6 (CF6) ELISA Kit

Sign In for Pricing
View Details
Rat Coupling Factor 6 (CF6) ELISA Kit
RD-CF6-Ra-02 48 Tests

Rat Coupling Factor 6 (CF6) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Sdr9c7 shRNA (UAS) - Lentiviral mouseSdr9c7 shRNA (UAS, GFP) (25)
GTR15110708 1 Vial

Lentiviral mouse Sdr9c7 shRNA (UAS) - Lentiviral mouseSdr9c7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CTGF Polyclonal Antibody
E911067 100 µL

CTGF Polyclonal Antibody

Sign In for Pricing
View Details
ARID3B 3'UTR GFP Stable Cell Line
TU051111 1.0 mL

ARID3B 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details