Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36A protein (Active)

This Human IL36A protein (Active) spans the amino acid sequence from region 6-158aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FIL1 epsilon, IL-1 epsilon, Interleukin-1 family member 6, IL-1F6

UniProt

Q9UHA7

Expression Region

6-158aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion in human preadipocytes is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris, 300 mM NaCl, pH 8.0, 0.1 % Tween 80

AA Sequence

KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRM2 Rabbit Polyclonal Antibody
orb3070562-01 30 µL

PRM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRM2 Rabbit Polyclonal Antibody
orb3070562-02 50 µL

PRM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRM2 Rabbit Polyclonal Antibody
orb3070562-03 100 µL

PRM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRM2 Rabbit Polyclonal Antibody
orb3070562-04 200 µL

PRM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lappaol B
M32157-01 100 mg

Lappaol B

Sign In for Pricing
View Details
Lappaol B
M32157-02 50 mg

Lappaol B

Sign In for Pricing
View Details