Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey IL3 protein (Active)

This Monkey IL3 protein (Active) spans the amino acid sequence from region 20-143aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-3, Mast cell growth factor, MCGF, Multipotential colony-stimulating factor, P-cell-stimulating factor

UniProt

P25140

Expression Region

20-143aa

Tag

Tag-Free

Source

E.Coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Assay #1: Fully biologically active when compared to standard. The ED50 as determined by the dose- dependent stimulation of the proliferation of murine NFS-60 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 5 IU/mg. Assay #2: The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, 5 % trehalose

AA Sequence

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0243406 1.0 µg DNA

C6orf26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Cystathionine r-Lyase/CTH
BP155-10ug 10 µg

Recombinant Human Cystathionine r-Lyase/CTH

Sign In for Pricing
View Details
TIGD1 Antibody
orb1333110 100 µg

TIGD1 Antibody

Sign In for Pricing
View Details
4-Methoxy-3- ((2-methylbenzyl) oxy) benzaldehyde
OR1007524-01 1 g

4-Methoxy-3- ((2-methylbenzyl) oxy) benzaldehyde

Sign In for Pricing
View Details
4-Methoxy-3- ((2-methylbenzyl) oxy) benzaldehyde
OR1007524-02 5 g

4-Methoxy-3- ((2-methylbenzyl) oxy) benzaldehyde

Sign In for Pricing
View Details
Bckdk-set siRNA/shRNA/RNAi Lentivector (Mouse)
13221094 4x 500 ng

Bckdk-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details