Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL19 protein (Active)

This Human IL19 protein (Active) spans the amino acid sequence from region 25-177aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-19, NG.1

UniProt

Q9UHD0

Expression Region

25-177aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Combretastatin A4
B6764-5 5 mg

Combretastatin A4

Sign In for Pricing
View Details
Peimine
SM4156-25mg 25 mg

Peimine

Sign In for Pricing
View Details
Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)
MBS1369837-01 0.02 mg (E-Coli)

Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)

Sign In for Pricing
View Details
Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)
MBS1369837-02 0.1 mg (E-Coli)

Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)

Sign In for Pricing
View Details
Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)
MBS1369837-03 0.02 mg (Yeast)

Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)

Sign In for Pricing
View Details
Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)
MBS1369837-04 0.1 mg (Yeast)

Recombinant Symbiobacterium thermophilum Probable 2-phosphosulfolactate phosphatase (comB)

Sign In for Pricing
View Details