Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL13 protein (Active)

This Human IL13 protein (Active) spans the amino acid sequence from region 35-146aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Allergic rhinitis protein, ALRH protein, BHR 1 protein, BHR-1 protein, BHR1 protein, IL 13 protein, IL-13 protein, IL13 protein, Interleukin 13 protein, Interleukin-13 protein, Interleukin13 protein, NC30 protein, P600 protein

UniProt

P35225

Expression Region

35-146aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zfp36l2 Pre-designed siRNA Set A
SI216332A 1 Each

Rat Zfp36l2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
USP1 (Ubiquitin-specific Processing Protease 1, USP1, UBP) discontinued
214071-01 50 µL

USP1 (Ubiquitin-specific Processing Protease 1, USP1, UBP) discontinued

Sign In for Pricing
View Details
USP1 (Ubiquitin-specific Processing Protease 1, USP1, UBP) discontinued
214071-02 100 µL

USP1 (Ubiquitin-specific Processing Protease 1, USP1, UBP) discontinued

Sign In for Pricing
View Details
USP1 (Ubiquitin-specific Processing Protease 1, USP1, UBP) discontinued
214071-03 200 µL

USP1 (Ubiquitin-specific Processing Protease 1, USP1, UBP) discontinued

Sign In for Pricing
View Details
Human CCDC50 qPCR Primer Pair
QH65565S 200 Tests

Human CCDC50 qPCR Primer Pair

Sign In for Pricing
View Details
SLC20A2 Polyclonal Antibody
MBS9238621-01 0.1 mL

SLC20A2 Polyclonal Antibody

Sign In for Pricing
View Details