Human IL3 protein (Active)
This Human IL3 protein (Active) spans the amino acid sequence from region 20-152aa (P27S) . Purity: > 96% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
IL-3, Mast cell growth factor, MCGF, Multipotential colony-stimulating factor, P-cell-stimulating factor
UniProt
P08700
Expression Region
20-152aa (P27S)
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 96% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 7 IU/mg.
Form
Lyophilized powder
Molecular Weight
15.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E0030076451 96 / PCK
Eppendorf epTIPS Box 2.0 IVD NS 50-1250uL 1 reusable box x 96 tips
Sign In for Pricing
View Details 
039740-APC 200 µL
PCDHB1, CT (PCDHB1, Protocadherin beta-1) (APC) discontinued
Sign In for Pricing
View Details MBS7249088-01 48 Well
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 6 (ADAMTS6) ELISA Kit
Sign In for Pricing
View Details MBS7249088-02 96 Well
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 6 (ADAMTS6) ELISA Kit
Sign In for Pricing
View Details MBS7249088-03 5x 96 Well
Rabbit A disintegrin and metalloproteinase with thrombospondin motifs 6 (ADAMTS6) ELISA Kit
Sign In for Pricing
View Details