Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL15 protein (Active)

This Human IL15 protein (Active) spans the amino acid sequence from region 49-162aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IL-15

UniProt

P40933

Expression Region

49-162aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg.

Form

Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA PKcs/PRKDC Rabbit Polyclonal Antibody (Cy3)
orb2576067 100 µg

DNA PKcs/PRKDC Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
ACAP1 antibody
70R-15531 50 μL

ACAP1 antibody

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)
MBS2133587-01 0.1 mL

FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)
MBS2133587-02 0.2 mL

FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)
MBS2133587-03 0.5 mL

FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)
MBS2133587-04 1 mL

FITC Linked Monoclonal Antibody to Alpha1Antitrypsin (a1AT)

Sign In for Pricing
View Details