Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Chid1 protein

This Mouse Chid1 protein spans the amino acid sequence from region 20-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chid1Chitinase domain-containing protein 1

UniProt

Q922Q9

Expression Region

20-393aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN3 (NM_024493) Human Tagged Lenti ORF Clone
RC202971L2 10 µg

ZKSCAN3 (NM_024493) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CYP2U1 (B-5) PE
sc-393071 PE 200 µg/mL

CYP2U1 (B-5) PE

Sign In for Pricing
View Details
DcR1 (TNFRSF10C) Human qPCR Primer Pair (NM_003841)
HP207290 200 Reactions

DcR1 (TNFRSF10C) Human qPCR Primer Pair (NM_003841)

Sign In for Pricing
View Details
MSMB (19E14) Mouse Monoclonal antibody
E28PE1529 100 µL

MSMB (19E14) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Josephin-3 HDR Plasmid (m)
sc-429054-HDR 20 µg

Josephin-3 HDR Plasmid (m)

Sign In for Pricing
View Details
KBTBD8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1115905 3x 1.0 µg

KBTBD8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details