Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Chid1 protein

This Mouse Chid1 protein spans the amino acid sequence from region 20-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chid1Chitinase domain-containing protein 1

UniProt

Q922Q9

Expression Region

20-393aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL13 ELISA Kit
orb561705-01 48 Tests

Human CXCL13 ELISA Kit

Sign In for Pricing
View Details
Human CXCL13 ELISA Kit
orb561705-02 96 Tests

Human CXCL13 ELISA Kit

Sign In for Pricing
View Details
Recombinant CD5 Antibody
V9516SAF-100UG 100 µg

Recombinant CD5 Antibody

Sign In for Pricing
View Details
RNFT2 Protein Vector (Mouse) (pPM-C-HA)
PV224960 500 ng

RNFT2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TRPV1 ELISA Kit (Human)
OKEH02208-96W 96 Well

TRPV1 ELISA Kit (Human)

Sign In for Pricing
View Details
NEK1 Antibody (C-term)
E45R06061G-4 50 µL

NEK1 Antibody (C-term)

Sign In for Pricing
View Details