Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Chid1 protein

This Mouse Chid1 protein spans the amino acid sequence from region 20-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chid1Chitinase domain-containing protein 1

UniProt

Q922Q9

Expression Region

20-393aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kcnn3 (NM_080466) AAV Particle
MR226692A1V 250 µL

Mouse Kcnn3 (NM_080466) AAV Particle

Sign In for Pricing
View Details
4-[ (Pyridin-2-yl) oxy]benzaldehyde
OR9651 1 g

4-[ (Pyridin-2-yl) oxy]benzaldehyde

Sign In for Pricing
View Details
Fenamole
orb1697227 25 mg

Fenamole

Sign In for Pricing
View Details
Polyclonal Antibody to Keratin 18 (Phospho-Ser33)
35-1276-50 50 μL

Polyclonal Antibody to Keratin 18 (Phospho-Ser33)

Sign In for Pricing
View Details
SF3B3 Protein Vector (Rat) (pPB-C-His)
PV304486 500 ng

SF3B3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Sheep Ubiquitin-Associated and SH3 Domain-Containing Protein B (UBASH3B) ELISA Kit
OM622083 96 Strip Well

Sheep Ubiquitin-Associated and SH3 Domain-Containing Protein B (UBASH3B) ELISA Kit

Sign In for Pricing
View Details