Rat FABP3 protein
This Rat FABP3 protein spans the amino acid sequence from region 2-133aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name, H-FABP
UniProt
P07483
Expression Region
2-133aa
Tag
N-terminal 6xHis-Myc-tagged
Source
Mammalian cell
Origin
Rattus norvegicus (Rat)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of HIS-tag and expression region is 18.62aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1435378-01 0.02 mg (E-Coli)
Recombinant Salmonella typhi L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
Sign In for Pricing
View Details MBS1435378-02 0.02 mg (Yeast)
Recombinant Salmonella typhi L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
Sign In for Pricing
View Details MBS1435378-03 0.1 mg (E-Coli)
Recombinant Salmonella typhi L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
Sign In for Pricing
View Details MBS1435378-04 0.1 mg (Yeast)
Recombinant Salmonella typhi L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
Sign In for Pricing
View Details MBS1435378-05 0.02 mg (Baculovirus)
Recombinant Salmonella typhi L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
Sign In for Pricing
View Details MBS1435378-06 0.02 mg (Mammalian-Cell)
Recombinant Salmonella typhi L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
Sign In for Pricing
View Details