Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLI2 protein

This Human GLI2 protein spans the amino acid sequence from region 412-641aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLI family zinc finger protein 2 Tax helper protein

UniProt

P10070

Expression Region

412-641aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of HIS-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Endoplasmic Reticulum To Nucleus Signalling 1 (ERN1) ELISA Kit
RDR-ERN1-Hu-01 96 Tests

Human Endoplasmic Reticulum To Nucleus Signalling 1 (ERN1) ELISA Kit

Sign In for Pricing
View Details
Human Endoplasmic Reticulum To Nucleus Signalling 1 (ERN1) ELISA Kit
RDR-ERN1-Hu-02 48 Tests

Human Endoplasmic Reticulum To Nucleus Signalling 1 (ERN1) ELISA Kit

Sign In for Pricing
View Details
Oxo Thiamine O-Diphosphate Ammonium Salt
TRC-O864220-1MG 1 mg

Oxo Thiamine O-Diphosphate Ammonium Salt

Sign In for Pricing
View Details
Human VGCNL1 (NALCN) activation kit by CRISPRa
GA116908 1 Kit

Human VGCNL1 (NALCN) activation kit by CRISPRa

Sign In for Pricing
View Details
TMIGD2 (NM_001169126) Human Over-expression Lysate
LC432814 20 µg

TMIGD2 (NM_001169126) Human Over-expression Lysate

Sign In for Pricing
View Details
ANXA11 Antibody
OC-092-01 50 μL

ANXA11 Antibody

Sign In for Pricing
View Details